PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010089440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family TALE
Protein Properties Length: 385aa    MW: 42708.9 Da    PI: 6.9244
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010089440.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.51.1e-083123462155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+ +q+ +WF N+R ++
  XP_010089440.1 312 KWPYPSEAQKLALAESTGLDLKQINNWFINQRKRH 346
                     569*****************************885 PP

2ELK40.84.7e-14266287122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  XP_010089440.1 266 ELKVQLLRKYSGYLGSLKQEFL 287
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.5E-17116160IPR005540KNOX1
PfamPF037902.6E-20117157IPR005540KNOX1
SMARTSM012567.3E-27178229IPR005541KNOX2
PfamPF037915.3E-22181228IPR005541KNOX2
SMARTSM011883.2E-7266287IPR005539ELK domain
PfamPF037896.9E-10266287IPR005539ELK domain
PROSITE profilePS5121311.278266286IPR005539ELK domain
PROSITE profilePS5007111.872286349IPR001356Homeobox domain
SMARTSM003891.1E-11288353IPR001356Homeobox domain
SuperFamilySSF466891.2E-19288365IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-28291351IPR009057Homeodomain-like
CDDcd000863.35E-12298350No hitNo description
PfamPF059207.0E-17306345IPR008422Homeobox KN domain
PROSITE patternPS000270324347IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MEFGDQNKYI SNSGSGVSSS AAASSLLQMM DINNSNNNNN SILPSMINNS GGTADRSRSS  60
ASSSRLNLHL PRPGLAHNNN PNQQHLRSGS SGPPFKPNDN LNITDTTTNT FSNNVSTMKA  120
KIMAHPLFPR LLTAYANCQK VGAPAEVVAR LEEACANNCE GTMGISTRSR SSNSSTTSTG  180
CIGEDPALDQ FMEAYCEMLA KYEQELTKPF KEAMLFLSKI ECQLKALTVS SASDSACVDF  240
AGQNGSSEEE VDVNDSIIDP QAEDKELKVQ LLRKYSGYLG SLKQEFLKKK KNGKLPKEAR  300
QQLLDWWSRH YKWPYPSEAQ KLALAESTGL DLKQINNWFI NQRKRHWKPS EDMQFVVMDT  360
AHPGHYYMDN IMYNPFPMDC SSTLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010089440.10.0Homeobox protein
SwissprotP466081e-132HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLW9QQI90.0W9QQI9_9R
STRINGVIT_12s0059g01190.t011e-147(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-119KNOX/ELK homeobox transcription factor